General Information

  • ID:  hor005740
  • Uniprot ID:  O44663??32-39)
  • Protein name:  GYGGYGGY-amide
  • Gene name:  nlp-30
  • Organism:  Caenorhabditis elegans
  • Family:  YARP (YGGW-amide related peptide) family
  • Source:  animal
  • Expression:  Upon D.coniospora infection. |Expressed in hypoderm.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GYGGYGGY
  • Length:  8(32-39)
  • Propeptide:  MISTSSILILVVLLACFMAASAQWGYGGYGRGYGGYGGYGRGYGGYGRGYGGYGRGMWGRPYGGYGWGK
  • Signal peptide:  MISTSSILILVVLLACFMAASA
  • Modification:  T8 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May have antimicrobial activity. May play a role in response to fungal infection.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O44663-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005740_AF2.pdbhor005740_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 91784 Formula: C37H44N8O12
Absent amino acids: ACDEFHIKLMNPQRSTVW Common amino acids: G
pI: 6.08 Basic residues: 0
Polar residues: 8 Hydrophobic residues: 0
Hydrophobicity: -73.75 Boman Index: 428
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: -1346.25 Extinction Coefficient cystines: 4470
Absorbance 280nm: 638.57

Literature

  • PubMed ID:  9851916
  • Title:  Genome sequence of the nematode C. elegans: a platform for investigating biology.
  • PubMed ID:  11717458
  • Title:  Identification of neuropeptide-like protein gene families in Caenorhabditiselegans and other species.
  • PubMed ID:  19380113
  • Title:  Antifungal innate immunity in C. elegans: PKCdelta links G protein si